Special Offers
Key Specifications Table
| Species Reactivity | Key Applications | Host | Format | Antibody Type |
|---|---|---|---|---|
| H, M, R, Ht | IP, WB | Rb | Purified | Polyclonal Antibody |
| Description | |
|---|---|
| Catalogue Number | 06-847-25UG |
| Brand Family | Upstate |
| Trade Name |
|
| Description | Anti-EGFR (rabbit polyclonal IgG) |
| Alternate Names |
|
| Background Information | The epidermal growth factor receptor (EGFR; ErbB-1; HER1 in humans) is the cell-surface receptor for members of the epidermal growth factor family (EGF-family) of extracellular protein ligands. The epidermal growth factor receptor is a member of the ErbB family of receptors, a subfamily of four closely related receptor tyrosine kinases: EGFR (ErbB-1), HER2/c-neu (ErbB-2), Her 3 (ErbB-3) and Her 4 (ErbB-4). Mutations affecting EGFR expression or activity could result in cancer. EGFR (epidermal growth factor receptor) exists on the cell surface and is activated by binding of its specific ligands, including epidermal growth factor and transforming growth factor α (TGFα). Upon activation by its growth factor ligands, EGFR undergoes a transition from an inactive monomeric form to an active homodimer. In addition to forming homodimers after ligand binding, EGFR may pair with another member of the ErbB receptor family, such as ErbB2/Her2/neu, to create an activated heterodimer. EGFR dimerization stimulates its intrinsic intracellular protein-tyrosine kinase activity. As a result, autophosphorylation of five tyrosine (Y) residues in the C-terminal domain of EGFR occurs. |
| Product Information | |
|---|---|
| Format | Purified |
| Control |
|
| Presentation | Purified rabbit polyclonal IgG in buffer containing 0.1M Tris-Glycine, 0.15M NaCl, 0.05% Sodium Azide, pH 7.4. Store at 2-8°C. |
| Quality Level | MQ100 |
| Applications | |
|---|---|
| Application | Anti-EGFR Antibody detects level of EGFR & has been published & validated for use in IP & WB. |
| Key Applications |
|
| Application Notes | Immunoprecipitation: 4 µg of a previous lot immunoprecipitated the EGFR from 500 µg of a 3T3/A31 RIPA cell lysate. Immunohistochemistry (Paraffin) Analysis: A 1:500 dilution of this antibody detected EGFR in human placenta tissue sections. |
| Biological Information | |
|---|---|
| Immunogen | Ovalbumin conjugated synthetic peptide (ETKPNGIFKGPTAENAEYLRVAPPSSEFIGA) corresponding to amino acids 1156-1186 of the processed mouse EGF receptor (EGFR) C-terminal domain (Accession number Q01279). The immunizing sequence shares 28/31 identity with the human EGF receptor sequence. |
| Concentration | Please refer to lot specific datasheet. |
| Host | Rabbit |
| Specificity | Recognizes the EGFR, Mr 180 kDa. |
| Isotype | IgG |
| Species Reactivity |
|
| Species Reactivity Note | Mouse and human. Reported to detect rat and hamster. |
| Antibody Type | Polyclonal Antibody |
| Entrez Gene Number |
|
| Entrez Gene Summary | The protein encoded by this gene is a transmembrane glycoprotein that is a member of the protein kinase superfamily. This protein is a receptor for members of the epidermal growth factor family. EGFR is a cell surface protein that binds to epidermal growth factor. Binding of the protein to a ligand induces receptor dimerization and tyrosine autophosphorylation and leads to cell proliferation. Mutations in this gene are associated with lung cancer. [provided by RefSeq] |
| Gene Symbol |
|
| Purification Method | Protein A chromatography |
| UniProt Number |
|
| UniProt Summary | FUNCTION: SwissProt: P00533 # Isoform 2/truncated isoform may act as an antagonist. SIZE: 1210 amino acids; 134277 Da SUBUNIT: Binds RIPK1. CBL interacts with the autophosphorylated C- terminal tail of the EGF receptor. Part of a complex with ERBB2 and either PIK3C2A or PIK3C2B. The autophosphorylated form interacts with PIK3C2B, maybe indirectly. Interacts with PELP1. SUBCELLULAR LOCATION: Cell membrane; Single-pass type I membrane protein. & Isoform 2: Secreted. TISSUE SPECIFICITY: Expressed in placenta. Isoform 2 is also expressed in ovarian cancers. PTM: Phosphorylation of Ser-695 is partial and occurs only if Thr- 693 is phosphorylated. & Monoubiquitinated and polyubiquitinated upon EGF stimulation; which does not affect tyrosine kinase activity or signaling capacity but may play a role in lysosomal targeting. Polyubiquitin linkage is mainly through Lys-63, but linkage through Lys-48, Lys-11 and Lys-29 also occur.DISEASE:SwissProt: P00533 # Defects in EGFR are associated with lung cancer [MIM:211980]. SIMILARITY: SwissProt: P00533 ## Belongs to the protein kinase superfamily. Tyr protein kinase family. EGF receptor subfamily. & Contains 1 protein kinase domain. MISCELLANEOUS: Binding of EGF to the receptor leads to dimerization, internalization of the EGF-receptor complex, induction of the tyrosine kinase activity, stimulation of cell DNA synthesis, and cell proliferation. |
| Molecular Weight | 180 kDa |
| Product Usage Statements | |
|---|---|
| Quality Assurance | Routinely evaluated by western blot on a mouse 3T3/A31 RIPA cell lysate. Western Blot Analysis: 0.5-2 µg/mL of this lot detected the EGFR from a mouse 3T3/A31 RIPA cell lysate. |
| Usage Statement |
|
| Storage and Shipping Information | |
|---|---|
| Storage Conditions | Stable for 1 year at 2-8°C from date of receipt. Handling Recommendations: Upon first thaw, and prior to removing the cap, centrifuge the vial and gently mix the solution. |
| Packaging Information | |
|---|---|
| Material Size | 25 μg |