We use cookies to make your experience better. To comply with the new e-Privacy directive, we need to ask for your consent to set the cookies. Learn about our cookie policy.
GenScript Sars-Cov-2 Spike Glycoprotein Rbd B.1.617.2-Delta; 1vial(25ug/peptide)
List Price $327.00 Your Price $327.00
GenScript Sars-Cov-2 Spike Glycoprotein Rbd B.1.617.2-Delta - GSCRPT (Additional S&H or Hazmat Fees May Apply)
NETA PART: GSCRPT-RP30034
MFG.PART: RP30034
UNSPSC: 12352202
Manufacturer: GenScript USA Inc


Overview
| Description | This pool is delivered in one pool of 53 peptides derived from a peptide scan through Spike glycoprotein - Receptor binding domain of SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2, Lineage B.1.617.2, India, Delta) covering the following mutations: L0452R and T0478K for T cell assays (e.g. ELISPOT). |
| Sequence | RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFK CYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNS NNLDSKVGGNYNYRYRLFRKSNLKPFERDISTEIYQAGSKPCNGVEGFNCYFPLQSYGFQ PTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF |
Properties
| Source | Severe Acute Respiratory Syndrome-related coronavirus 2 (Lineage B.1.617.2) Spike glycoprotein - Receptor-binding domain (covering the following mutations: L0452R and T0478K). |
| Gene ID | S |
| Length | 223 aa |
| Purity | Crude (Major peak by ESI-MS is guaranteed to be peptide of interest - determined at 220 nm for each individual peptide). |
| Solubility | Dissolve in a minimum amount of pure DMSO (approx. 50 µl) and dilute with PBS buffer to the final concentration. Please note that the final concentration of DMSO must be below 1 % (v/v) to avoid toxicity in the biological system. |
| Form | Lyophilized |
| Storage | Store at -20°C. |
| Note | The peptides of this product are supplied as trifluoroacetate salts. |
| SKU | GSCRPT-RP30034 |
|---|---|
| Supplier Part Number | RP30034 |
| UM | EA |
| UNSPSC | 12352202 |
| Manufacturer | GenScript USA Inc |
| CountryOfOrigin | United States |
| ProductLine | GSCRPT |
| Qty | 1 |
| MinOrderQty | 1 |
| Weight | 7.000000 |
| Lead Time | 7 |
| Hazardous | N |
| Energy Star | No |
| Green | No |
| Controlled | N |

